PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT25084
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 342aa    MW: 37531.3 Da    PI: 6.0079
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT25084genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.12.5e-55231501129
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101
               lppGfrFhPtdee++++yL++k+ ++++    vi evd++k+ePw+Lp k+k +ekewyfF+++d+ky+tg+r+nrat+sgyWkatgkdke+++ +g lvg
  EMT25084  23 LPPGFRFHPTDEEIISHYLTPKALDHRFCS-GVIGEVDLNKCEPWHLPGKAKMGEKEWYFFCHKDRKYPTGTRTNRATESGYWKATGKDKEIFRGRGVLVG 122
               79*************************888.89***************99999************************************************ PP

       NAM 102 lkktLvfykgrapkgektdWvmheyrle 129
               +kktLvfy grap+gekt Wvmhe+rle
  EMT25084 123 MKKTLVFYLGRAPRGEKTGWVMHEFRLE 150
               *************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-6317173IPR003441NAC domain
PROSITE profilePS5100557.1923173IPR003441NAC domain
PfamPF023658.7E-2924149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MSEASVLNQA EVEDAAAAAG LALPPGFRFH PTDEEIISHY LTPKALDHRF CSGVIGEVDL  60
NKCEPWHLPG KAKMGEKEWY FFCHKDRKYP TGTRTNRATE SGYWKATGKD KEIFRGRGVL  120
VGMKKTLVFY LGRAPRGEKT GWVMHEFRLE GKLPHPLPRS AKDEWAVSKV FNKELTATNG  180
AMAAAEAGIE RVSSFGFIGD FLDSGELPPL MDPPLGGDVD EVIDFKSTSA YATGAHSGLQ  240
VKMEQHMPQQ PPHMMYSSPY FSLPAANSGD MSPAIRRYCK AEQVSGQTSA LSPSRETGLS  300
TDPNAAGCAE ISSAATPSSQ NQDFLDQFDE YPALNLADIW KY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D9e-53121779172NAC domain-containing protein 19
3swp_C9e-53121779172NAC domain-containing protein 19
3swp_B9e-53121779172NAC domain-containing protein 19
3swp_A9e-53121779172NAC domain-containing protein 19
3swm_D9e-53121779172NAC domain-containing protein 19
3swm_C9e-53121779172NAC domain-containing protein 19
3swm_B9e-53121779172NAC domain-containing protein 19
3swm_A9e-53121779172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3762970.0AK376297.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3120C21.
GenBankFR8197630.0FR819763.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC013 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558001.10.0PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLR38e-82NAC79_ARATH; NAC domain-containing protein 79
TrEMBLM8BSZ70.0M8BSZ7_AEGTA; Protein CUP-SHAPED COTYLEDON 2
STRINGMLOC_64057.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.29e-80Arabidopsis NAC domain containing protein 87